Lineage for d1npma_ (1npm A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Neuropsin [50525] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50526] (1 PDB entry) 
Domain d1npma_: 1npm A: [26070]
complexed with nag
Details for d1npma_
PDB Entry: 1npm (more details), 2.1 Å
PDB Description: neuropsin, a serine protease expressed in the limbic system of mouse brain
PDB Compounds: (A:) neuropsinSCOPe Domain Sequences for d1npma_:
Sequence, based on SEQRES records: (download)
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]}
ilegreciphsqpwqaalfqgerlicggvlvgdrwvltaahckkqkysvrlgdhslqsrd
qpeqeiqvaqsiqhpcynnsnpedhshdimlirlqnsanlgdkvkpvqlanlcpkvgqkc
iisgwgtvtspqenfpntlncaevkiysqnkceraypgkitegmvcagssngadtcqgds
ggplvcdgmlqgitswgsdpcgkpekpgvytkicryttwikktmd
Sequence, based on observed residues (ATOM records): (download)
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]}
ilegreciphsqpwqaalfqgerlicggvlvgdrwvltaahckkqkysvrlgdhslqsqp
eqeiqvaqsiqhpcynnsnpedhshdimlirlqnsanlgdkvkpvqlanlcpkvgqkcii
sgwgtvtspqenfpntlncaevkiysqnkceraypgkitegmvcagssngadtcqgdsgg
plvcdgmlqgitswgsdpcgkpekpgvytkicryttwikktmd
SCOPe Domain Coordinates for d1npma_:
Click to download the PDB-style file with coordinates for d1npma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1npma_:
- d1npma_ first appeared (with stable ids) in SCOP 1.55
- d1npma_ appears in SCOPe 2.07
View in 3D
