Lineage for d1hska2 (1hsk A:209-317)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (2 families) 
Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein) Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species)
N-terminal domain is a FAD-binding domain
Species Staphylococcus aureus [TaxId:1280] [64417] (1 PDB entry) 
Domain d1hska2: 1hsk A:209-317 [61242]
Other proteins in same PDB: d1hska1
complexed with fad
Details for d1hska2
PDB Entry: 1hsk (more details), 2.3 Å
PDB Description: crystal structure of s. aureus murb
PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductaseSCOPe Domain Sequences for d1hska2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hska2 d.146.1.1 (A:209-317) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
gkmteiqakmddlterreskqpleypscgsvfqrppghfagkliqdsnlqghriggvevs
tkhagfmvnvdngtatdyenlihyvqktvkekfgielnrevriigehpk
SCOPe Domain Coordinates for d1hska2:
Click to download the PDB-style file with coordinates for d1hska2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hska2:
- d1hska2 first appeared in SCOP 1.57
- d1hska2 appears in SCOPe 2.04
- d1hska2 appears in SCOPe 2.06
- d1hska2 appears in the current release, SCOPe 2.08
View in 3D
