Lineage for d1hska1 (1hsk A:15-208)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1933670Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1933671Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1933745Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein)
  6. 1933746Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (2 species)
  7. 1933753Species Staphylococcus aureus [TaxId:1280] [64416] (1 PDB entry)
  8. 1933754Domain d1hska1: 1hsk A:15-208 [61241]
    Other proteins in same PDB: d1hska2
    complexed with fad

Details for d1hska1

PDB Entry: 1hsk (more details), 2.3 Å

PDB Description: crystal structure of s. aureus murb
PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductase

SCOPe Domain Sequences for d1hska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
nkdiyqalqqlipnekikvdeplkrytytktggnadfyitptkneevqavvkyayqneip
vtylgngsniiireggirgivisllsldhievsddaiiagsgaaiidvsrvardyaltgl
efacgipgsiggavymnagayggevkdcidyalcvneqgsliklttkeleldyrnsiiqk
ehlvvleaaftlap

SCOPe Domain Coordinates for d1hska1:

Click to download the PDB-style file with coordinates for d1hska1.
(The format of our PDB-style files is described here.)

Timeline for d1hska1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hska2