Lineage for d1hska2 (1hsk A:209-317)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548193Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2548194Superfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (2 families) (S)
  5. 2548195Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein)
  6. 2548196Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species)
    N-terminal domain is a FAD-binding domain
  7. 2548203Species Staphylococcus aureus [TaxId:1280] [64417] (1 PDB entry)
  8. 2548204Domain d1hska2: 1hsk A:209-317 [61242]
    Other proteins in same PDB: d1hska1
    complexed with fad

Details for d1hska2

PDB Entry: 1hsk (more details), 2.3 Å

PDB Description: crystal structure of s. aureus murb
PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductase

SCOPe Domain Sequences for d1hska2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hska2 d.146.1.1 (A:209-317) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
gkmteiqakmddlterreskqpleypscgsvfqrppghfagkliqdsnlqghriggvevs
tkhagfmvnvdngtatdyenlihyvqktvkekfgielnrevriigehpk

SCOPe Domain Coordinates for d1hska2:

Click to download the PDB-style file with coordinates for d1hska2.
(The format of our PDB-style files is described here.)

Timeline for d1hska2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hska1