Lineage for d1ar1c_ (1ar1 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740120Domain d1ar1c_: 1ar1 C: [20207]
    Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2, d1ar1d_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase
    complexed with ca, cu, hea, lda, mg

Details for d1ar1c_

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment
PDB Compounds: (C:) antibody fv fragment

SCOPe Domain Sequences for d1ar1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1c_ b.1.1.1 (C:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

SCOPe Domain Coordinates for d1ar1c_:

Click to download the PDB-style file with coordinates for d1ar1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ar1c_: