Lineage for d1a5fl1 (1a5f L:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511793Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)
  8. 1511845Domain d1a5fl1: 1a5f L:1-113 [20302]
    Other proteins in same PDB: d1a5fh1, d1a5fh2, d1a5fl2
    part of an anti-E-selectin Fab

Details for d1a5fl1

PDB Entry: 1a5f (more details), 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody
PDB Compounds: (L:) monoclonal anti-e-selectin 7a9 antibody (light chain)

SCOPe Domain Sequences for d1a5fl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5fl1 b.1.1.1 (L:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvttgekvtmtckssqsllnsgaqknyltwyqqkpgqspklliywastr
esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelk

SCOPe Domain Coordinates for d1a5fl1:

Click to download the PDB-style file with coordinates for d1a5fl1.
(The format of our PDB-style files is described here.)

Timeline for d1a5fl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5fl2