PDB entry 1a5f

View 1a5f on RCSB PDB site
Description: fab fragment of a monoclonal anti-e-selectin antibody
Class: immunoglobulin
Keywords: immunoglobulin, fab, antibody, anti-e-selectin
Deposited on 1998-02-16, released 1999-04-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.195
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal anti-e-selectin 7a9 antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1A5F (0-216)
    Domains in SCOPe 2.04: d1a5fh1, d1a5fh2
  • Chain 'L':
    Compound: monoclonal anti-e-selectin 7a9 antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA72671 (0-219)
      • conflict (11)
      • conflict (13-14)
      • conflict (17)
      • conflict (21)
      • conflict (33)
      • conflict (37)
      • conflict (39)
      • conflict (48)
      • conflict (55)
      • conflict (79)
      • conflict (82)
      • conflict (96-98)
    Domains in SCOPe 2.04: d1a5fl1, d1a5fl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a5fH (H:)
    evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
    dptfkgkatitaddssntaylqmssltsedtavyycarvglsywyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvsvptstetvtcnvahapsstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5fH (H:)
    evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
    dptfkgkatitaddssntaylqmssltsedtavyycarvyamdywgqgtsvtvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvsvptstetvtcnvahapsstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5fL (L:)
    divmtqspssltvttgekvtmtckssqsllnsgaqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec