PDB entry 6erz

View 6erz on RCSB PDB site
Description: The crystal structure of mouse chloride intracellular channel protein 6
Class: transport protein
Keywords: CLIC, GST, Glutathione Transferase, Ion channel, CHLORIDE CHANNEL, TRANSPORT PROTEIN
Deposited on 2017-10-19, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride intracellular channel protein 6
    Species: Mus musculus [TaxId:10090]
    Gene: Clic6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BHB9 (4-237)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6erza1, d6erza2, d6erza3
  • Chain 'B':
    Compound: Chloride intracellular channel protein 6
    Species: Mus musculus [TaxId:10090]
    Gene: Clic6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BHB9 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6erzb1, d6erzb2, d6erzb3
  • Heterogens: TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6erzA (A:)
    gamgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtn
    ppfmtfdgevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkk
    daneiyeknllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpk
    lhiikivakkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erzA (A:)
    mgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdltnppfmtfdgevktdvn
    kieefleeklvpprypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralk
    kldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfe
    fpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6erzB (B:)
    gamgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtn
    ppfmtfdgevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkk
    daneiyeknllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpk
    lhiikivakkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erzB (B:)
    mgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrknlapgtnppfmtfd
    gevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkkdaneiye
    knllralkkldsylnsplpdeidssedvtvsqrkfldgdeltladcnllpklhiikivak
    kyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakr