Lineage for d6erza1 (6erz A:5-88)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (173 species)
    not a true protein
  7. 2458413Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 3052000Domain d6erza1: 6erz A:5-88 [352062]
    Other proteins in same PDB: d6erza2, d6erza3, d6erzb2, d6erzb3
    automated match to d3tgza1
    complexed with so4, trs

Details for d6erza1

PDB Entry: 6erz (more details), 1.92 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6
PDB Compounds: (A:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6erza1:

Sequence, based on SEQRES records: (download)

>d6erza1 c.47.1.0 (A:5-88) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnppfm
tfdgevktdvnkieefleeklvpp

Sequence, based on observed residues (ATOM records): (download)

>d6erza1 c.47.1.0 (A:5-88) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdltnppfmtfdgevktdvnki
eefleeklvpp

SCOPe Domain Coordinates for d6erza1:

Click to download the PDB-style file with coordinates for d6erza1.
(The format of our PDB-style files is described here.)

Timeline for d6erza1:

  • d6erza1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17