Lineage for d6erza2 (6erz A:89-238)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2323031Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries)
  8. 3052001Domain d6erza2: 6erz A:89-238 [352063]
    Other proteins in same PDB: d6erza1, d6erza3, d6erzb1, d6erzb3
    automated match to d3tgza2
    complexed with so4, trs

Details for d6erza2

PDB Entry: 6erz (more details), 1.92 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6
PDB Compounds: (A:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6erza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6erza2 a.45.1.0 (A:89-238) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralkkldsylnsplpde
idadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfefpsemtgiwryln
nayardeftntcpadreiehaysdaakrmk

SCOPe Domain Coordinates for d6erza2:

Click to download the PDB-style file with coordinates for d6erza2.
(The format of our PDB-style files is described here.)

Timeline for d6erza2:

  • d6erza2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17