PDB entry 5k52

View 5k52 on RCSB PDB site
Description: Crystal structures of aldehyde deformylating oxygenase from Limnothrix sp. KNUA012
Class: metal binding protein
Keywords: ferritin-like di-iron protein, METAL BINDING PROTEIN
Deposited on 2016-05-23, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde decarbonylase
    Species: Limnothrix sp. KNUA012 [TaxId:1162714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k52a_
  • Chain 'B':
    Compound: Aldehyde decarbonylase
    Species: Limnothrix sp. KNUA012 [TaxId:1162714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k52b_
  • Chain 'C':
    Compound: Aldehyde decarbonylase
    Species: Limnothrix sp. KNUA012 [TaxId:1162714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k52c_
  • Chain 'D':
    Compound: Aldehyde decarbonylase
    Species: Limnothrix sp. KNUA012 [TaxId:1162714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k52d_
  • Heterogens: OCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k52A (A:)
    hhhhhhssglvprgshmasmtggqqmgrgsefmpqleataaidyqsetykdaysrinaiv
    iegedeaannyvrlaelmpeqseelaslakmearhkkgftacgknlnvtpdmdfakkffs
    dlhgnfqvaaaagnivtclliqaliieafaisaynvyiphaddfarkitenvvkdeylhl
    nfgeqwlkanfesakdeleranrenlaivwrmldevagdalvlgmekealmedftiayqe
    alqnigfstretlrmltaglaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k52A (A:)
    idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
    cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
    ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
    vlgmekealmedftiayqealqnigfstretlrmltaglaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k52B (B:)
    hhhhhhssglvprgshmasmtggqqmgrgsefmpqleataaidyqsetykdaysrinaiv
    iegedeaannyvrlaelmpeqseelaslakmearhkkgftacgknlnvtpdmdfakkffs
    dlhgnfqvaaaagnivtclliqaliieafaisaynvyiphaddfarkitenvvkdeylhl
    nfgeqwlkanfesakdeleranrenlaivwrmldevagdalvlgmekealmedftiayqe
    alqnigfstretlrmltaglaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k52B (B:)
    idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
    cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
    ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
    vlgmekealmedftiayqealqnigfstretlrmltaglaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k52C (C:)
    hhhhhhssglvprgshmasmtggqqmgrgsefmpqleataaidyqsetykdaysrinaiv
    iegedeaannyvrlaelmpeqseelaslakmearhkkgftacgknlnvtpdmdfakkffs
    dlhgnfqvaaaagnivtclliqaliieafaisaynvyiphaddfarkitenvvkdeylhl
    nfgeqwlkanfesakdeleranrenlaivwrmldevagdalvlgmekealmedftiayqe
    alqnigfstretlrmltaglaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k52C (C:)
    idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
    cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
    ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
    vlgmekealmedftiayqealqnigfstretlrmltaglaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k52D (D:)
    hhhhhhssglvprgshmasmtggqqmgrgsefmpqleataaidyqsetykdaysrinaiv
    iegedeaannyvrlaelmpeqseelaslakmearhkkgftacgknlnvtpdmdfakkffs
    dlhgnfqvaaaagnivtclliqaliieafaisaynvyiphaddfarkitenvvkdeylhl
    nfgeqwlkanfesakdeleranrenlaivwrmldevagdalvlgmekealmedftiayqe
    alqnigfstretlrmltaglaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k52D (D:)
    idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
    cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
    ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
    vlgmekealmedftiayqealqnigfstretlrmltaglaa