SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k52b_ (5k52 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990501Family a.25.1.6: PMT1231-like [158402] (2 protein domains)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 1990512Protein automated matches [261918] (4 species)
    not a true protein
  7. 2287742Species Limnothrix sp. [TaxId:1162714] [331043] (1 PDB entry)
  8. 2287825Domain d5k52b_: 5k52 B: [331126]
    automated match to d4z5sa_
    complexed with ocd

Details for d5k52b_

PDB Entry: 5k52 (more details), 2.4 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012
PDB Compounds: (B:) Aldehyde decarbonylase

SCOPe Domain Sequences for d5k52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k52b_ a.25.1.6 (B:) automated matches {Limnothrix sp. [TaxId: 1162714]}
idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
vlgmekealmedftiayqealqnigfstretlrmltaglaa

SCOPe Domain Coordinates for d5k52b_:

Click to download the PDB-style file with coordinates for d5k52b_.
(The format of our PDB-style files is described here.)

Timeline for d5k52b_:

  • d5k52b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16