Lineage for d5k52c_ (5k52 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314590Family a.25.1.6: PMT1231-like [158402] (2 protein domains)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2314601Protein automated matches [261918] (5 species)
    not a true protein
  7. 2314602Species Limnothrix sp. [TaxId:1162714] [331043] (1 PDB entry)
  8. 2314605Domain d5k52c_: 5k52 C: [331081]
    automated match to d4z5sa_
    complexed with ocd

Details for d5k52c_

PDB Entry: 5k52 (more details), 2.4 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012
PDB Compounds: (C:) Aldehyde decarbonylase

SCOPe Domain Sequences for d5k52c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k52c_ a.25.1.6 (C:) automated matches {Limnothrix sp. [TaxId: 1162714]}
idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
vlgmekealmedftiayqealqnigfstretlrmltaglaa

SCOPe Domain Coordinates for d5k52c_:

Click to download the PDB-style file with coordinates for d5k52c_.
(The format of our PDB-style files is described here.)

Timeline for d5k52c_: