Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.12: FIS-like [100918] (4 proteins) |
Protein Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain [101001] (1 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [101002] (1 PDB entry) |
Domain d1umqa_: 1umq A: [99625] |
PDB Entry: 1umq (more details)
SCOPe Domain Sequences for d1umqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} lakgeslppppenpmsadrvrwehiqriyemcdrnvsetarrlnmhrrtlqrilakrspr
Timeline for d1umqa_: