Lineage for d1umqa_ (1umq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692555Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 2692619Protein Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain [101001] (1 species)
  7. 2692620Species Rhodobacter sphaeroides [TaxId:1063] [101002] (1 PDB entry)
  8. 2692621Domain d1umqa_: 1umq A: [99625]

Details for d1umqa_

PDB Entry: 1umq (more details)

PDB Description: solution structure and dna binding of the effector domain from the global regulator prra(rega) from r. sphaeroides: insights into dna binding specificity
PDB Compounds: (A:) photosynthetic apparatus regulatory protein

SCOPe Domain Sequences for d1umqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]}
lakgeslppppenpmsadrvrwehiqriyemcdrnvsetarrlnmhrrtlqrilakrspr

SCOPe Domain Coordinates for d1umqa_:

Click to download the PDB-style file with coordinates for d1umqa_.
(The format of our PDB-style files is described here.)

Timeline for d1umqa_: