PDB entry 1umq

View 1umq on RCSB PDB site
Description: solution structure and DNA binding of the effector domain from the global regulator prra(rega) from r. sphaeroides: insights into DNA binding specificity
Class: DNA-binding protein
Keywords: DNA-binding protein, response regulator, DNA binding domain, helix-turn-helix, nmr, sensory transduction, phosphorylation, transcription regulation, DNA-binding, activator
Deposited on 2003-08-28, released 2003-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: photosynthetic apparatus regulatory protein
  Species: Rhodobacter sphaeroides [TaxId:1063]
  Database cross-references and differences (RAF-indexed):
  • PDB 1UMQ
  • Uniprot Q53228 (21-80)
  Domains in SCOPe 2.07: d1umqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1umqA (A:)
  mgsshhhhhhssglvprgshmlakgeslppppenpmsadrvrwehiqriyemcdrnvset
  arrlnmhrrtlqrilakrspr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1umqA (A:)
  lakgeslppppenpmsadrvrwehiqriyemcdrnvsetarrlnmhrrtlqrilakrspr