SCOPe 2.08: Domain d1ulna1: 1uln A:1-42

Lineage for d1ulna1 (1uln A:1-42)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)

6. Protein Lectin-D [103524] (1 species)
   consists of two homologous domains

7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)

8. Domain d1ulna1: 1uln A:1-42 [99569]
   isoform D1

Details for d1ulna1

PDB Entry: 1uln, 1.65 Å

PDB Description: Crystal Structure of Pokeweed Lectin-D1

PDB Compounds: (A:) lectin-D

SCOPe Domain Sequences for d1ulna1:

Sequence; same for both SEQRES and ATOM records:

>d1ulna1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

Timeline for d1ulna1:

• d1ulna1 first appeared in SCOP 1.67
  
• d1ulna1 appears in SCOPe 2.07