PDB entry 1uln

View 1uln on RCSB PDB site
Description: Crystal Structure of Pokeweed Lectin-D1
Class: sugar binding protein
Keywords: lectin, chitin-binding domain, SUGAR BINDING PROTEIN
Deposited on 2003-09-16, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.172
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin-D
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulna1, d1ulna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ulnA (A:)
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
skygwcgysddhcedgcqsqcdlt

    Sequence, based on observed residues (ATOM records): (download) 
    >1ulnA (A:)
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
skygwcgysddhcedgcqsqcd