Lineage for d1ulna1 (1uln A:1-42)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427259Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 427260Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)
  6. 427291Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 427292Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 427295Domain d1ulna1: 1uln A:1-42 [99569]

Details for d1ulna1

PDB Entry: 1uln (more details), 1.65 Å

PDB Description: Crystal Structure of Pokeweed Lectin-D1

SCOP Domain Sequences for d1ulna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulna1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana)}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

SCOP Domain Coordinates for d1ulna1:

Click to download the PDB-style file with coordinates for d1ulna1.
(The format of our PDB-style files is described here.)

Timeline for d1ulna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulna2