Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Obg GTP-binding protein middle domain [82408] (2 species) |
Species Thermus thermophilus [TaxId:274] [102368] (1 PDB entry) TT1381 |
Domain d1udxa2: 1udx A:157-336 [99229] Other proteins in same PDB: d1udxa1, d1udxa3 complexed with act, mpd |
PDB Entry: 1udx (more details), 2.07 Å
SCOPe Domain Sequences for d1udxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} iadvglvgypnagkssllaamtrahpkiapypfttlspnlgvvevseeerftladipgii egasegkglgleflrhiartrvllyvldaadeplktletlrkevgaydpallrrpslval nkvdlleeeavkaladalareglavlpvsaltgaglpalkealhalvrstpppempkpvp
Timeline for d1udxa2: