Lineage for d1udxa2 (1udx A:157-336)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867315Protein Obg GTP-binding protein middle domain [82408] (2 species)
  7. 2867319Species Thermus thermophilus [TaxId:274] [102368] (1 PDB entry)
    TT1381
  8. 2867320Domain d1udxa2: 1udx A:157-336 [99229]
    Other proteins in same PDB: d1udxa1, d1udxa3
    complexed with act, mpd

Details for d1udxa2

PDB Entry: 1udx (more details), 2.07 Å

PDB Description: Crystal structure of the conserved protein TT1381 from Thermus thermophilus HB8
PDB Compounds: (A:) the GTP-binding protein Obg

SCOPe Domain Sequences for d1udxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}
iadvglvgypnagkssllaamtrahpkiapypfttlspnlgvvevseeerftladipgii
egasegkglgleflrhiartrvllyvldaadeplktletlrkevgaydpallrrpslval
nkvdlleeeavkaladalareglavlpvsaltgaglpalkealhalvrstpppempkpvp

SCOPe Domain Coordinates for d1udxa2:

Click to download the PDB-style file with coordinates for d1udxa2.
(The format of our PDB-style files is described here.)

Timeline for d1udxa2: