![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.117: Obg-fold [82050] (1 superfamily) this fold is formed by three glycine-rich regions inserted into a small 8-stranded beta-sandwich these regions form six left-handed collagen-like helices packed and H-bonded together |
![]() | Superfamily b.117.1: Obg GTP-binding protein N-terminal domain [82051] (1 family) ![]() automatically mapped to Pfam PF01018 |
![]() | Family b.117.1.1: Obg GTP-binding protein N-terminal domain [82052] (1 protein) |
![]() | Protein Obg GTP-binding protein N-terminal domain [82053] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [101668] (1 PDB entry) TT1381 |
![]() | Domain d1udxa1: 1udx A:1-156 [99228] Other proteins in same PDB: d1udxa2, d1udxa3 complexed with act, mpd |
PDB Entry: 1udx (more details), 2.07 Å
SCOPe Domain Sequences for d1udxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udxa1 b.117.1.1 (A:1-156) Obg GTP-binding protein N-terminal domain {Thermus thermophilus [TaxId: 274]} mfqdvlvitvaagrggdgavsfrrekfvpkggpdggdggrggsvylrargsvdslsrlsk rtykaedgehgrgsqqhgrggedlvievprgtrvfdadtgelladlteegqtvlvargga ggrgnmhfvsptrqaprfaeageegekrrlrlelml
Timeline for d1udxa1: