Lineage for d1udxa1 (1udx A:1-156)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382703Fold b.117: Obg-fold [82050] (1 superfamily)
    this fold is formed by three glycine-rich regions inserted into a small 8-stranded beta-sandwich
    these regions form six left-handed collagen-like helices packed and H-bonded together
  4. 382704Superfamily b.117.1: Obg GTP-binding protein N-terminal domain [82051] (1 family) (S)
  5. 382705Family b.117.1.1: Obg GTP-binding protein N-terminal domain [82052] (1 protein)
  6. 382706Protein Obg GTP-binding protein N-terminal domain [82053] (2 species)
  7. 382710Species Thermus thermophilus [TaxId:274] [101668] (1 PDB entry)
    TT1381
  8. 382711Domain d1udxa1: 1udx A:1-156 [99228]
    Other proteins in same PDB: d1udxa2, d1udxa3
    complexed with act, mpd

Details for d1udxa1

PDB Entry: 1udx (more details), 2.07 Å

PDB Description: Crystal structure of the conserved protein TT1381 from Thermus thermophilus HB8

SCOP Domain Sequences for d1udxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udxa1 b.117.1.1 (A:1-156) Obg GTP-binding protein N-terminal domain {Thermus thermophilus}
mfqdvlvitvaagrggdgavsfrrekfvpkggpdggdggrggsvylrargsvdslsrlsk
rtykaedgehgrgsqqhgrggedlvievprgtrvfdadtgelladlteegqtvlvargga
ggrgnmhfvsptrqaprfaeageegekrrlrlelml

SCOP Domain Coordinates for d1udxa1:

Click to download the PDB-style file with coordinates for d1udxa1.
(The format of our PDB-style files is described here.)

Timeline for d1udxa1: