Lineage for d1udxa2 (1udx A:157-336)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393967Protein Obg GTP-binding protein middle domain [82408] (2 species)
  7. 393971Species Thermus thermophilus [TaxId:274] [102368] (1 PDB entry)
    TT1381
  8. 393972Domain d1udxa2: 1udx A:157-336 [99229]
    Other proteins in same PDB: d1udxa1, d1udxa3
    complexed with act, mpd

Details for d1udxa2

PDB Entry: 1udx (more details), 2.07 Å

PDB Description: Crystal structure of the conserved protein TT1381 from Thermus thermophilus HB8

SCOP Domain Sequences for d1udxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus}
iadvglvgypnagkssllaamtrahpkiapypfttlspnlgvvevseeerftladipgii
egasegkglgleflrhiartrvllyvldaadeplktletlrkevgaydpallrrpslval
nkvdlleeeavkaladalareglavlpvsaltgaglpalkealhalvrstpppempkpvp

SCOP Domain Coordinates for d1udxa2:

Click to download the PDB-style file with coordinates for d1udxa2.
(The format of our PDB-style files is described here.)

Timeline for d1udxa2: