SCOPe 2.08: Domain d1sqya1: 1sqy A:1-334

Lineage for d1sqya1 (1sqy A:1-334)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)

8. Domain d1sqya1: 1sqy A:1-334 [98973]
   complexed with co3, fe

Details for d1sqya1

PDB Entry: 1sqy, 2.5 Å

PDB Description: structure of human diferric lactoferrin at 2.5a resolution using crystals grown at ph 6.5

PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1sqya1:

Sequence; same for both SEQRES and ATOM records:

>d1sqya1 c.94.1.2 (A:1-334) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
grrrsvqwctvsnpeatkcfqwqrnmrrvrgppvscvkrdsptqciqaiaenradavtld
ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspafqlfgspsgqkdllf
kdsaigfsrvppridsglylgsgyftaiqnlrks

Timeline for d1sqya1:

• d1sqya1 first appeared in SCOP 1.67
  
• d1sqya1 appears in SCOPe 2.07