Lineage for d1sqya2 (1sqy A:335-691)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2915041Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)
  8. 2915064Domain d1sqya2: 1sqy A:335-691 [98974]
    complexed with co3, fe

Details for d1sqya2

PDB Entry: 1sqy (more details), 2.5 Å

PDB Description: structure of human diferric lactoferrin at 2.5a resolution using crystals grown at ph 6.5
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1sqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqya2 c.94.1.2 (A:335-691) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
eeevaarrarvvwcavgeqelrkcnqwsglsegsvtcssasttedcialvlkgeadamsl
dggyvytagkcglvpvlaenyksqqssdpdpncvdrpvegylavavvrrsdtsltwnsvk
gkkschtavdrtagwnipmgllfnqtgsckfdeyfsqscapgrdprsnlcalcigdeqge
nkcvpnsneryygytgafrclaenagdvafvkdvtvlqntdgnnneawakdlkladfall
cldgkrkpvtearschlamapnhavvsrmdkverlkqvllhqqakfgrngsdcpdkfclf
qsetknllfndnteclarlhgkttyekylgpqyvagitnlkkcstsplleaceflrk

SCOPe Domain Coordinates for d1sqya2:

Click to download the PDB-style file with coordinates for d1sqya2.
(The format of our PDB-style files is described here.)

Timeline for d1sqya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqya1