Lineage for d1sqya1 (1sqy A:1-334)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (3 proteins)
further duplication: composed of two two-domain lobes
Protein Lactoferrin [53889] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries) 
Domain d1sqya1: 1sqy A:1-334 [98973]
Details for d1sqya1
PDB Entry: 1sqy (more details), 2.5 Å
PDB Description: structure of human diferric lactoferrin at 2.5a resolution using crystals grown at ph 6.5
SCOP Domain Sequences for d1sqya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqya1 c.94.1.2 (A:1-334) Lactoferrin {Human (Homo sapiens)}
grrrsvqwctvsnpeatkcfqwqrnmrrvrgppvscvkrdsptqciqaiaenradavtld
ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspafqlfgspsgqkdllf
kdsaigfsrvppridsglylgsgyftaiqnlrks
SCOP Domain Coordinates for d1sqya1:
Click to download the PDB-style file with coordinates for d1sqya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sqya1:
- d1sqya1 is new in SCOP 1.67
- d1sqya1 appears in SCOP 1.69
- d1sqya1 appears in the current release, SCOPe 2.08
View in 3D
