SCOP 1.67: Domain d1sd7a_: 1sd7 A:

Lineage for d1sd7a_ (1sd7 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain

6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)

7. Species Staphyloccocus aureus [101018] (4 PDB entries)

8. Domain d1sd7a_: 1sd7 A: [98805]

Details for d1sd7a_

PDB Entry: 1sd7, 2.65 Å

PDB Description: Crystal Structure of a SeMet derivative of MecI at 2.65 A

SCOP Domain Sequences for d1sd7a_:

Sequence; same for both SEQRES and ATOM records:

>d1sd7a_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphyloccocus aureus}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnkk

Timeline for d1sd7a_:

• d1sd7a_ is new in SCOP 1.67
  
• d1sd7a_ appears in SCOP 1.69
  
• d1sd7a_ appears in the current release, SCOPe 2.08