Lineage for d1sd7b_ (1sd7 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 352121Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
  6. 352122Protein Methicillin resistance regulatory protein MecI [101017] (1 species)
  7. 352123Species Staphyloccocus aureus [101018] (4 PDB entries)
  8. 352129Domain d1sd7b_: 1sd7 B: [98806]

Details for d1sd7b_

PDB Entry: 1sd7 (more details), 2.65 Å

PDB Description: Crystal Structure of a SeMet derivative of MecI at 2.65 A

SCOP Domain Sequences for d1sd7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd7b_ a.4.5.39 (B:) Methicillin resistance regulatory protein MecI {Staphyloccocus aureus}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnk

SCOP Domain Coordinates for d1sd7b_:

Click to download the PDB-style file with coordinates for d1sd7b_.
(The format of our PDB-style files is described here.)

Timeline for d1sd7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sd7a_