PDB entry 1sd7

View 1sd7 on RCSB PDB site
Description: Crystal Structure of a SeMet derivative of MecI at 2.65 A
Deposited on 2004-02-13, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1sd7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1sd7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sd7A (A:)
    mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
    kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
    nkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd7A (A:)
    tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
    kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sd7B (B:)
    mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
    kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
    nkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sd7B (B:)
    tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
    kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnk