SCOPe 2.08: Domain d1s3jb_: 1s3j B:

Lineage for d1s3jb_ (1s3j B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Putative transcriptional regulator YusO [101012] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101013] (1 PDB entry)

8. Domain d1s3jb_: 1s3j B: [98438]
   structural genomics

Details for d1s3jb_

PDB Entry: 1s3j, 2.25 Å

PDB Description: X-ray crystal structure of YusO protein from Bacillus subtilis

PDB Compounds: (B:) YusO protein

SCOPe Domain Sequences for d1s3jb_:

Sequence; same for both SEQRES and ATOM records:

>d1s3jb_ a.4.5.28 (B:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]}
ksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerm
evkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryls
flteeemlqaahitaklaqaa

Timeline for d1s3jb_:

• d1s3jb_ first appeared in SCOP 1.67
  
• d1s3jb_ appears in SCOPe 2.07