PDB entry 1s3j

View 1s3j on RCSB PDB site
Description: X-ray crystal structure of YusO protein from Bacillus subtilis
Class: transcription
Keywords: Structural genomics, YusO protein, MarR transcriptional regulator family, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-01-13, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YusO protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yusO
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32181
      • modified residue (7)
      • modified residue (25)
      • modified residue (29)
      • modified residue (60)
      • modified residue (70)
      • modified residue (115)
      • modified residue (127)
    Domains in SCOPe 2.07: d1s3ja_
  • Chain 'B':
    Compound: YusO protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yusO
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32181
      • modified residue (7)
      • modified residue (25)
      • modified residue (29)
      • modified residue (60)
      • modified residue (70)
      • modified residue (115)
      • modified residue (127)
    Domains in SCOPe 2.07: d1s3jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3jA (A:)
    mksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaer
    mevkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryl
    sflteeemlqaahitaklaqaaetdekqnmkrgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3jA (A:)
    sadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerme
    vkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimarylsf
    lteeemlqaahitaklaqaaetd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3jB (B:)
    mksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaer
    mevkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryl
    sflteeemlqaahitaklaqaaetdekqnmkrgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3jB (B:)
    ksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerm
    evkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryls
    flteeemlqaahitaklaqaa