![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (16 species) |
![]() | Species Bacillus globisporus [TaxId:1459] [102342] (1 PDB entry) contains a zinc-finger subdomain, residues 126-160 |
![]() | Domain d1s3ga1: 1s3g A:1-125,A:161-217 [98433] Other proteins in same PDB: d1s3ga2 complexed with ap5, zn |
PDB Entry: 1s3g (more details), 2.25 Å
SCOPe Domain Sequences for d1s3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} mnivlmglpgagkgtqadrivekygtphistgdmfraaiqegtelgvkaksfmdqgalvp devtigivrerlsksdcdngflldgfprtvpqaealdqlladmgrkiehvlniqvekeel iarltXaddnpdtvtnrlevnmnqtapllafydskevlvningqkdikdvfkdldvilqg ngq
Timeline for d1s3ga1: