SCOPe 2.08: Domain d1s3ga1: 1s3g A:1-125,A:161-217

Lineage for d1s3ga1 (1s3g A:1-125,A:161-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Bacillus globisporus [TaxId:1459] [102342] (1 PDB entry)
   contains a zinc-finger subdomain, residues 126-160

8. Domain d1s3ga1: 1s3g A:1-125,A:161-217 [98433]
   Other proteins in same PDB: d1s3ga2
   complexed with ap5, zn

Details for d1s3ga1

PDB Entry: 1s3g, 2.25 Å

PDB Description: Crystal structure of adenylate kinase from Bacillus globisporus

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1s3ga1:

Sequence; same for both SEQRES and ATOM records:

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}
mnivlmglpgagkgtqadrivekygtphistgdmfraaiqegtelgvkaksfmdqgalvp
devtigivrerlsksdcdngflldgfprtvpqaealdqlladmgrkiehvlniqvekeel
iarltXaddnpdtvtnrlevnmnqtapllafydskevlvningqkdikdvfkdldvilqg
ngq

Timeline for d1s3ga1:

• d1s3ga1 first appeared in SCOP 1.67
  
• d1s3ga1 appears in SCOPe 2.07