PDB entry 1s3g

View 1s3g on RCSB PDB site
Description: Crystal structure of adenylate kinase from Bacillus globisporus
Class: transferase
Keywords: psychrophile, TRANSFERASE
Deposited on 2004-01-13, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Sporosarcina globispora [TaxId:1459]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s3ga1, d1s3ga2
  • Heterogens: ZN, AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s3gA (A:)
    mnivlmglpgagkgtqadrivekygtphistgdmfraaiqegtelgvkaksfmdqgalvp
    devtigivrerlsksdcdngflldgfprtvpqaealdqlladmgrkiehvlniqvekeel
    iarltgrrickvcgtsyhllfnppqvegkcdkdggelyqraddnpdtvtnrlevnmnqta
    pllafydskevlvningqkdikdvfkdldvilqgngq