Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein Isobutyryl-CoA dehydrogenase [101144] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101145] (1 PDB entry) |
Domain d1rx0b1: 1rx0 B:241-393 [98009] Other proteins in same PDB: d1rx0a2, d1rx0b2, d1rx0c2, d1rx0d2 complexed with 2mc, acy, edo, fad |
PDB Entry: 1rx0 (more details), 1.77 Å
SCOPe Domain Sequences for d1rx0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx0b1 a.29.3.1 (B:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy avqqyvrdsrvhqilegsnevmrilisrsllqe
Timeline for d1rx0b1: