![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
![]() | Protein Isobutyryl-CoA dehydrogenase [103394] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103395] (1 PDB entry) |
![]() | Domain d1rx0d2: 1rx0 D:10-240 [98014] Other proteins in same PDB: d1rx0a1, d1rx0b1, d1rx0c1, d1rx0d1 complexed with 2mc, acy, edo, fad |
PDB Entry: 1rx0 (more details), 1.77 Å
SCOPe Domain Sequences for d1rx0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx0d2 e.6.1.1 (D:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} tscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyi qtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplct mekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpg pkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
Timeline for d1rx0d2: