SCOPe 2.08: Domain d1rx0a2: 1rx0 A:10-240

Lineage for d1rx0a2 (1rx0 A:10-240)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein Isobutyryl-CoA dehydrogenase [103394] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103395] (1 PDB entry)

8. Domain d1rx0a2: 1rx0 A:10-240 [98008]
   Other proteins in same PDB: d1rx0a1, d1rx0b1, d1rx0c1, d1rx0d1
   complexed with 2mc, acy, edo, fad

Details for d1rx0a2

PDB Entry: 1rx0, 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.

PDB Compounds: (A:) Acyl-CoA dehydrogenase family member 8, mitochondrial

SCOPe Domain Sequences for d1rx0a2:

Sequence; same for both SEQRES and ATOM records:

>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
tscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyi
qtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplct
mekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpg
pkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse

Timeline for d1rx0a2:

• d1rx0a2 first appeared in SCOP 1.67
  
• d1rx0a2 appears in SCOPe 2.07