![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
![]() | Protein Neurotoxin bmk37 [103544] (1 species) |
![]() | Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103545] (2 PDB entries) |
![]() | Domain d1r1gb_: 1r1g B: [96817] |
PDB Entry: 1r1g (more details), 1.72 Å
SCOPe Domain Sequences for d1r1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1gb_ g.3.7.2 (B:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]} aacyssdcrvkcvamgfssgkcinskckcyk
Timeline for d1r1gb_: