SCOPe 2.08: Domain d1r1gb_: 1r1g B:

Lineage for d1r1gb_ (1r1g B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein Neurotoxin bmk37 [103544] (1 species)

7. Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103545] (2 PDB entries)

8. Domain d1r1gb_: 1r1g B: [96817]

Details for d1r1gb_

PDB Entry: 1r1g, 1.72 Å

PDB Description: crystal structure of the scorpion toxin bmbkttx1

PDB Compounds: (B:) Neurotoxin BmK37

SCOPe Domain Sequences for d1r1gb_:

Sequence; same for both SEQRES and ATOM records:

>d1r1gb_ g.3.7.2 (B:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]}
aacyssdcrvkcvamgfssgkcinskckcyk

Timeline for d1r1gb_:

• d1r1gb_ first appeared in SCOP 1.67
  
• d1r1gb_ appears in SCOPe 2.07