PDB entry 1r1g

View 1r1g on RCSB PDB site
Description: Crystal Structure of the Scorpion Toxin BmBKTtx1
Class: toxin
Keywords: SIRAS from S atoms, scorpion toxin, BmBKTtx1, reductive dimethylation, TOXIN
Deposited on 2003-09-23, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin BmK37
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83407 (0-30)
      • see remark 999 (0)
      • see remark 999 (10)
      • see remark 999 (20)
      • see remark 999 (25)
      • see remark 999 (27)
      • see remark 999 (30)
    Domains in SCOPe 2.08: d1r1ga_
  • Chain 'B':
    Compound: Neurotoxin BmK37
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83407 (0-30)
      • see remark 999 (0)
      • see remark 999 (10)
      • see remark 999 (20)
      • see remark 999 (25)
      • see remark 999 (27)
      • see remark 999 (30)
    Domains in SCOPe 2.08: d1r1gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1gA (A:)
    aacyssdcrvkcvamgfssgkcinskckcyk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r1gB (B:)
    aacyssdcrvkcvamgfssgkcinskckcyk