Lineage for d1r1ga_ (1r1g A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030662Protein Neurotoxin bmk37 [103544] (1 species)
  7. 3030663Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103545] (2 PDB entries)
  8. 3030664Domain d1r1ga_: 1r1g A: [96816]

Details for d1r1ga_

PDB Entry: 1r1g (more details), 1.72 Å

PDB Description: crystal structure of the scorpion toxin bmbkttx1
PDB Compounds: (A:) Neurotoxin BmK37

SCOPe Domain Sequences for d1r1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1ga_ g.3.7.2 (A:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]}
aacyssdcrvkcvamgfssgkcinskckcyk

SCOPe Domain Coordinates for d1r1ga_:

Click to download the PDB-style file with coordinates for d1r1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r1ga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r1gb_