SCOPe 2.08: Domain d1qzwe1: 1qzw E:1-87

Lineage for d1qzwe1 (1qzw E:1-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [101121] (3 PDB entries)

8. Domain d1qzwe1: 1qzw E:1-87 [96705]
   Other proteins in same PDB: d1qzwa2, d1qzwa3, d1qzwc2, d1qzwc3, d1qzwe2, d1qzwe3, d1qzwg2, d1qzwg3
   protein/RNA complex

Details for d1qzwe1

PDB Entry: 1qzw, 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

PDB Compounds: (E:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzwe1:

Sequence; same for both SEQRES and ATOM records:

>d1qzwe1 a.24.13.1 (E:1-87) Signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
psvlerkewfisivydelsklfggdke

Timeline for d1qzwe1:

• d1qzwe1 first appeared in SCOP 1.67
  
• d1qzwe1 appears in SCOPe 2.07