PDB entry 1qzw

View 1qzw on RCSB PDB site
Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
Class: Signaling Protein/RNA
Keywords: Signal recognition particle, SRP, ribonucleoprotein complex, protein-RNA complex, protein targeting, Signaling Protein-RNA COMPLEX
Deposited on 2003-09-18, released 2003-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.34
AEROSPACI score: -0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qzwa1, d1qzwa2, d1qzwa3
  • Chain 'B':
    Compound: 7s RNA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: 7S RNA
  • Chain 'C':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qzwc1, d1qzwc2, d1qzwc3
  • Chain 'D':
    Compound: 7s RNA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: 7S RNA
  • Chain 'E':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qzwe1, d1qzwe2, d1qzwe3
  • Chain 'F':
    Compound: 7s RNA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: 7S RNA
  • Chain 'G':
    Compound: signal recognition 54 kda protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SRP54
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qzwg1, d1qzwg2, d1qzwg3
  • Chain 'H':
    Compound: 7s RNA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: 7S RNA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzwA (A:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzwA (A:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipglgimlp
    tpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellew
    ynnmnrllkmvk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qzwC (C:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzwC (C:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipglgimlp
    tpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellew
    ynnmnrllkmvk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qzwE (E:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzwE (E:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipglgimlp
    tpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellew
    ynnmnrllkmvk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qzwG (G:)
    mghhhhhhmlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakik
    erlnkekppsvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgkttt
    agklayfykkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvd
    ifvknkmdiiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasr
    fhqaspigsviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsril
    gmgdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhi
    pglgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleve
    evrellewynnmnrllkmvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzwG (G:)
    mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
    psvlerkewfisivydelsklfggdkepnvnptklpfiimlvgvqgsgktttagklayfy
    kkrgykvglvaadvyrpaaydqllqlgnqigvqvygepnnqnpieiakkgvdifvknkmd
    iiivdtagrhgygeetklleemkemydvlkpddvilvidasigqkaydlasrfhqaspig
    sviitkmdgtakgggalsavvatgatikfigtgekideletfnakrfvsrilgmgdiesi
    lekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipglgimlp
    tpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellew
    ynnmnrllkmvk
    

  • Chain 'H':
    No sequence available.