SCOP 1.73: Domain d1qvfq_: 1qvf Q:

Lineage for d1qvfq_ (1qvf Q:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)

8. Domain d1qvfq_: 1qvf Q: [96379]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   complexed with cd, cl, k, mg, na

Details for d1qvfq_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Q:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1qvfq_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfq_ d.55.1.1 (Q:) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1qvfq_:

• d1qvfq_ first appeared in SCOP 1.67
  
• d1qvfq_ appears in SCOP 1.71
  
• d1qvfq_ appears in SCOP 1.75
  
• d1qvfq_ appears in the current release, SCOPe 2.08