SCOP 1.73: Domain d1qvfp_: 1qvf P:

Lineage for d1qvfp_ (1qvf P:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)

8. Domain d1qvfp_: 1qvf P: [96378]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   complexed with cd, cl, k, mg, na

Details for d1qvfp_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (P:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1qvfp_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfp_ b.34.5.1 (P:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1qvfp_:

• d1qvfp_ first appeared in SCOP 1.67
  
• d1qvfp_ appears in SCOP 1.71
  
• d1qvfp_ appears in SCOP 1.75
  
• d1qvfp_ appears in the current release, SCOPe 2.08