SCOP 1.73: Domain d1qvfy_: 1qvf Y:

Lineage for d1qvfy_ (1qvf Y:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)

8. Domain d1qvfy_: 1qvf Y: [96387]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfz_
   complexed with cd, cl, k, mg, na

Details for d1qvfy_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Y:) L37Ae 50S ribosomal protein

SCOP Domain Sequences for d1qvfy_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

Timeline for d1qvfy_:

• d1qvfy_ first appeared in SCOP 1.67
  
• d1qvfy_ appears in SCOP 1.71
  
• d1qvfy_ appears in SCOP 1.75
  
• d1qvfy_ appears in the current release, SCOPe 2.08