SCOP 1.73: Domain d1qvff_: 1qvf F:

Lineage for d1qvff_ (1qvf F:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)

8. Domain d1qvff_: 1qvf F: [96368]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   complexed with cd, cl, k, mg, na

Details for d1qvff_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1qvff_:

Sequence; same for both SEQRES and ATOM records:

>d1qvff_ d.79.3.1 (F:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1qvff_:

• d1qvff_ first appeared in SCOP 1.67
  
• d1qvff_ appears in SCOP 1.71
  
• d1qvff_ appears in SCOP 1.75
  
• d1qvff_ appears in the current release, SCOPe 2.08