Lineage for d1qvfn_ (1qvf N:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690462Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 690463Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 690464Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 690517Protein Ribosomal protein L18e [52084] (1 species)
  7. 690518Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
  8. 690556Domain d1qvfn_: 1qvf N: [96376]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfn_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1qvfn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfn_ c.12.1.1 (N:) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1qvfn_:

Click to download the PDB-style file with coordinates for d1qvfn_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfn_: