Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) |
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
Protein Ribosomal protein L5 [55284] (3 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (19 PDB entries) |
Domain d1qvfd_: 1qvf D: [96365] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOP Domain Sequences for d1qvfd_:
Sequence, based on SEQRES records: (download)
>d1qvfd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui} fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d1qvfd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui} fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk hrlnpadavafiestydvev
Timeline for d1qvfd_:
View in 3D Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |