![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
![]() | Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) incomplete OB-fold lacking the last strand |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (19 PDB entries) includes the N-terminal tail |
![]() | Domain d1qvfa2: 1qvf A:1-90 [96362] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOP Domain Sequences for d1qvfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui} grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1qvfa2:
![]() Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |