SCOP 1.71: Domain d1qvfu_: 1qvf U:

Lineage for d1qvfu_ (1qvf U:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)

8. Domain d1qvfu_: 1qvf U: [96383]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   complexed with cd, cl, k, mg, na

Details for d1qvfu_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfu_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfu_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1qvfu_:

• d1qvfu_ first appeared in SCOP 1.67
  
• d1qvfu_ appears in SCOP 1.69
  
• d1qvfu_ appears in SCOP 1.73
  
• d1qvfu_ appears in the current release, SCOPe 2.08