Lineage for d1qvfh_ (1qvf H:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602120Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 602121Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 602122Protein Ribosomal protein L10e [54688] (1 species)
  7. 602123Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (19 PDB entries)
  8. 602132Domain d1qvfh_: 1qvf H: [96370]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfh_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:)

SCOP Domain Sequences for d1qvfh_:

Sequence, based on SEQRES records: (download)

>d1qvfh_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1qvfh_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1qvfh_:

Click to download the PDB-style file with coordinates for d1qvfh_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfh_: