Lineage for d1qvf2_ (1qvf 2:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624941Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 624986Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 624987Protein Ribosomal protein L44e [57837] (1 species)
  7. 624988Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (19 PDB entries)
  8. 624997Domain d1qvf2_: 1qvf 2: [96360]
    Other proteins in same PDB: d1qvf1_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvf2_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:)

SCOP Domain Sequences for d1qvf2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvf2_ g.41.8.3 (2:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1qvf2_:

Click to download the PDB-style file with coordinates for d1qvf2_.
(The format of our PDB-style files is described here.)

Timeline for d1qvf2_: